Abnova Corporation

Designed for the clinical and in vitro diagnostic industries, Abnova products are manufactured in an ISO13485 and GMP-certified facility and an ISO15189 medical laboratory. They include rabbit monoclonal antibodies, ELISA kits, FISH probes, and CytoQuest™ CR systems.

Narrow Results

Classification

Cocktail (3)
Monoclonal (30,287)
Monoclonal/Polyclonal (3,639)
Polyclonal (31,318)

Regulatory Status

RUO (59,878)

Recombinant

Recombinant (30,246)
Yes (611)

1 – 15of96,344results

Abnova™ SFRS14 293T Cell Transient Overexpression Lysate (Denatured) (T02)

Human overexpression lysate

Pricing & Availability

Abnova™ Human SGK Partial ORF (AAH01263, 1 a.a. - 90 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Pricing & Availability
Specifications

Form	Liquid
Common Name	SGK1
Molecular Weight (g/mol)	35.64kDa
Gene Symbol	SGK1
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Expression System	wheat germ expression system
For Use With (Application)	Antibody Production,ELISA,Protein Array,Western Blot
Name	SGK (Human) Recombinant Protein (Q01)
Accession Number	AAH01263
Regulatory Status	RUO
Gene Alias	SGK
Gene ID (Entrez)	6446
Formulation	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Immunogen	MTVKTEAAKGTLTYSRMRGMVAILIAFMKQRRMGLNDFIQKIANNSYACKHPEVQSILKISQPQEPELMNANPSPPPSPSQQINLGPSSN
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Protein Tag	GST
Species	Wheat Germ (in vitro)
Recombinant	Recombinant

Abnova™ SHC3 293T Cell Transient Overexpression Lysate (Denatured)

Human overexpression lysate

Pricing & Availability

Abnova™ Human SIRT7 Partial ORF (NP_057622, 191 a.a. - 300 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Pricing & Availability
Specifications

Form	Liquid
Common Name	SIRT7
Molecular Weight (g/mol)	37.84kDa
Gene Symbol	SIRT7
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Expression System	wheat germ expression system
For Use With (Application)	Antibody Production,ELISA,Protein Array,Western Blot
Name	SIRT7 (Human) Recombinant Protein (Q01)
Accession Number	NP_057622
Regulatory Status	RUO
Gene Alias	MGC126840/MGC126842/SIR2L7
Gene ID (Entrez)	51547
Formulation	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Immunogen	YIEVCTSCVPNREYVRVFDVTERTALHRHQTGRTCHKCGTQLRDTIVHFGERGTLGQPLNWEAATEAASRADTILCLGSSLKVLKKYPRLWCMTKPPSRRPKLYIVNLQW
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Protein Tag	GST
Species	Wheat Germ (in vitro)
Recombinant	Recombinant

Abnova™ Human SHPRH Partial ORF (NP_775105, 1560 a.a. - 1659 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Pricing & Availability
Specifications

Form	Liquid
Common Name	SHPRH
Molecular Weight (g/mol)	36.74kDa
Gene Symbol	SHPRH
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Expression System	wheat germ expression system
For Use With (Application)	Antibody Production,ELISA,Protein Array,Western Blot
Name	SHPRH (Human) Recombinant Protein (Q01)
Accession Number	NP_775105
Regulatory Status	RUO
Gene Alias	FLJ27258/FLJ37625/FLJ45012/FLJ90837/KIAA2023/MGC134886/bA545I5.2
Gene ID (Entrez)	257218
Formulation	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Immunogen	AQISRVKTFQENLSAFKRDPQINILLLPLHTGSNGLTIIEATHVLLVEPILNPAHELQAIGRVHRIGQTKPTIVHRFLIKATIEERMQAMLKTAERSIYI
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Protein Tag	GST
Species	Wheat Germ (in vitro)
Recombinant	Recombinant

Abnova™ Human SIGLEC5 Partial ORF (NP_003821, 465 a.a. - 549 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Pricing & Availability
Specifications

Form	Liquid
Common Name	SIGLEC5
Molecular Weight (g/mol)	35.09kDa
Gene Symbol	SIGLEC5
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Expression System	wheat germ expression system
For Use With (Application)	Antibody Production,ELISA,Protein Array,Western Blot
Name	SIGLEC5 (Human) Recombinant Protein (Q01)
Accession Number	NP_003821
Regulatory Status	RUO
Gene Alias	CD170/CD33L2/OB-BP2/OBBP2/SIGLEC-5
Gene ID (Entrez)	8778
Formulation	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Immunogen	RRKQAAGRPEKMDDEDPIMGTITSGSRKKPWPDSPGDQASPPGDAPPLEEQKELHYASLSFSEMKSREPKDQEAPSTTEYSEIKT
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Protein Tag	GST
Species	Wheat Germ (in vitro)
Recombinant	Recombinant

Abnova™ Human SIPA1 Partial ORF (AAH10492, 933 a.a. - 1042 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Pricing & Availability
Specifications

Form	Liquid
Common Name	SIPA1
Molecular Weight (g/mol)	37.73kDa
Gene Symbol	SIPA1
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Expression System	wheat germ expression system
For Use With (Application)	Antibody Production,ELISA,Protein Array,Western Blot
Name	SIPA1 (Human) Recombinant Protein (Q01)
Accession Number	AAH10492
Regulatory Status	RUO
Gene Alias	MGC102688/MGC17037/SPA1
Gene ID (Entrez)	6494
Formulation	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Immunogen	SEIASTCNTILESLSREGQPIPESGDPKGTPKSDAEPEPGNLSEKVSHLESMLRKLQEDLQKEKADRAALEEEVRSLRHNNRRLQAESESAATRLLLASKQLGSPTADLA
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Protein Tag	GST
Species	Wheat Germ (in vitro)
Recombinant	Recombinant

Abnova™ SLAMF1 (Human) ELISA Kit

For the Quantitative detection of Human SLAMF1.

Pricing & Availability

Abnova™ Human SIK2 (NP_056006.1, 1 a.a. - 926 a.a.) Full-length Recombinant Protein with GST-tag expressed in baculovirus infected Sf21 cells

Used for Func, SDS-PAGE

Pricing & Availability

Abnova™ SIL1 293T Cell Transient Overexpression Lysate (Denatured)

Human overexpression lysate

Pricing & Availability

Abnova™ Human SLC12A1 Full-length ORF (ENSP00000331550, 1 a.a. - 430 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Pricing & Availability
Specifications

Form	Liquid
Common Name	SLC12A1
Molecular Weight (g/mol)	72.9kDa
Gene Symbol	SLC12A1
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Expression System	wheat germ expression system
For Use With (Application)	Antibody Production,Protein Array,ELISA,Western Blot
Name	SLC12A1 (Human) Recombinant Protein (P01)
Accession Number	ENSP00000331550
Regulatory Status	RUO
Purification Method	Glutathione Sepharose 4 Fast Flow
Gene Alias	BSC1/MGC48843/NKCC2
Gene ID (Entrez)	6557
Formulation	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Immunogen	MSLNNSSNVFLDSVPSNTNRFQVSVINENHESSAAADDNTDPPHYEETSFGDEAQKRLRISFRPGNQECYDNFLQSGETAKTDASFHAYDSHTNTYYLQTFGHNTMDAVPKIEYYRNTGSISGPKVNRPSLLEIHEQLAKNVAVTPSSADRVANGDGIPGDEQAENKEDDQAGVVKFGWVKGVLVRCMLNIWGVMLFIRLSWIVGEAGIGLGVLIILLSTMVTSITGLSTSAIATNGFVRGGGAYYLISRSLGPEFGGSIGLIFAFANAVAVAMYVVGFAETVVDLLKESDSMMVDPTNDIRIIGSITVVILLGISVAGMEWEAKAQVILLVILLIAIANFFIGTVIPSNNEKKSRGFFNYQASIFAENFGPRFTKGEGFFSVFAIFFPAATGILAGANISGDLEALRKQGASPLPQGAQSRRRRQTSLI
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Protein Tag	GST
Species	Wheat Germ (in vitro)
Recombinant	Recombinant

Abnova™ Human SLC13A3 Partial ORF (NP_073740, 152 a.a. - 232 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Pricing & Availability
Specifications

Form	Liquid
Common Name	SLC13A3
Molecular Weight (g/mol)	34.65kDa
Gene Symbol	SLC13A3
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Expression System	wheat germ expression system
For Use With (Application)	Antibody Production,ELISA,Protein Array,Western Blot
Name	SLC13A3 (Human) Recombinant Protein (Q01)
Accession Number	NP_073740
Regulatory Status	RUO
Gene Alias	NADC3/SDCT2
Gene ID (Entrez)	64849
Formulation	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Immunogen	LPIANAILKSLFGQKEVRKDPSQESEENTAAVRRNGLHTVPTEMQFLASTEAKDHPGETEVPLDLPADSRKEDEYRRNIWK
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Protein Tag	GST
Species	Wheat Germ (in vitro)
Recombinant	Recombinant

Abnova™ Human SIPA1L2 Full-length ORF (AAH13119.1, 1 a.a. - 532 a.a.) Recombinant Protein MW: 84kDa with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Pricing & Availability
Specifications

Form	Liquid
Common Name	SIPA1L2
Molecular Weight (g/mol)	84kDa
Gene Symbol	SIPA1L2
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Expression System	wheat germ expression system
For Use With (Application)	Antibody Production,Protein Array,ELISA,Western Blot
Name	SIPA1L2 (Human) Recombinant Protein (P02)
Accession Number	AAH13119.1
Regulatory Status	RUO
Purification Method	Glutathione Sepharose 4 Fast Flow
Gene Alias	FLJ23126/FLJ23632/KIAA1389/SPAL2
Gene ID (Entrez)	57568
Formulation	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Immunogen	MEASRHPETKWHGPPSKVLGSYKERALQKDGSCKDSPNKLSHIGDKSCSSHSSSNTLSSNTSSNSDDKHFGSGDLMDPELLGLTYIKGASTDSGIDTAPCMPATILGPVHLAGSRSLIHSRAEQWADAADVSGPDDEPAKLYSVHGYASAISAGSAAEGSMGDLSEISSHSSGSHHSGSPSAHCSKSSGSLDSSKVYIVSHSSGQQVPGSMSKPYHRQGAVNKYVIGWKKSEGSPPPEEPEVTECPGMYSEMDVMSTATQHQTVVGDAVAETQHVLSKEDFLKLMLPDSPLVEEGRRKFSFYGNLSPRRSLYRTLSDESICSNRRGSSFGSSRSSVLDQALPNDILFSTTPPYHSTLPPRAHPAPSMGSLRNEFWFSDGSLSDKSKCADPGLMPLPDTATGLDWTHLVDAARAFEDQRVASFCTLTDMQHGQDLEGAQELPLCVDPGSGKEFMDTTGERSPSPLTGKVNQLELILRQLQTDLRKEKQDKAVLQAEVQHLRQDNMRLQEESQTATAQLRKFTEWFFTTIDKKS
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Protein Tag	GST
Species	Wheat Germ (in vitro)
Recombinant	Recombinant

Abnova™ Human SLC10A6 Full-length ORF (NP_932069.1, 1 a.a. - 377 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Pricing & Availability

Abnova™ Human SIP1 Full-length ORF (NP_003607.1, 1 a.a. - 280 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Pricing & Availability

Prev
1
2
3
4
5
6
...
6,423
Next

Welcome to fishersci.com

Abnova Corporation

Filtered Search Results

Narrow Results